Owner's Manual
Page 9
...hoifs allows you press the 'Needle up/down : If you press this button. Touch to close the window, save your foot 3 mm, 'medium" off the 6 mm aWtahndedhjuefnso'htoeiytgdohw,u"istZperh, reo9eus"mtsTtmhhthee. menus ...wnreDisrstasiraoeintnneifndortgher"vveaieapsmrrstolhueoglintsruiga-nbcmtauoilsstlto,yoyronyotu.oouuupkcrdeheeestspsecrtrtmhheeeeinnbbe.uuttthttooennleapngrgeatsihns.eodf .the 5 seams with set of the machine Your Pfaff creative 2144 is doepteernmedinfeorwthheisthpeurrapnodseh. Sewing functions for the machine can simultaneously foot control. Thread cutter: If you...
...hoifs allows you press the 'Needle up/down : If you press this button. Touch to close the window, save your foot 3 mm, 'medium" off the 6 mm aWtahndedhjuefnso'htoeiytgdohw,u"istZperh, reo9eus"mtsTtmhhthee. menus ...wnreDisrstasiraoeintnneifndortgher"vveaieapsmrrstolhueoglintsruiga-nbcmtauoilsstlto,yoyronyotu.oouuupkcrdeheeestspsecrtrtmhheeeeinnbbe.uuttthttooennleapngrgeatsihns.eodf .the 5 seams with set of the machine Your Pfaff creative 2144 is doepteernmedinfeorwthheisthpeurrapnodseh. Sewing functions for the machine can simultaneously foot control. Thread cutter: If you...
Owner's Manual
Page 10
... your Pfatf creative 2144. 1 Tptorheicvsailoilcuousnplycaoddnoefnisreimgwnsitsfhreoltmehcettihcoeunrscsaowrrdhs..i)c(hFoyrouexhaamvpele 2. To close a window without saving any changes color and the func tions of the selection menus. ) Creative Assistant The Creative Assistant time. "j Closes the Creative Assistant Opens the Sewing and Embroidery Assistant Opens the Machine Assistant Your Pfaff individual creative 2144 has a Pop-up Direct current menu, and also on your Pfaff creative 2144. IHf eylopuptroouvcihdetsheinformatiiocnonown...
... your Pfatf creative 2144. 1 Tptorheicvsailoilcuousnplycaoddnoefnisreimgwnsitsfhreoltmehcettihcoeunrscsaowrrdhs..i)c(hFoyrouexhaamvpele 2. To close a window without saving any changes color and the func tions of the selection menus. ) Creative Assistant The Creative Assistant time. "j Closes the Creative Assistant Opens the Sewing and Embroidery Assistant Opens the Machine Assistant Your Pfaff individual creative 2144 has a Pop-up Direct current menu, and also on your Pfaff creative 2144. IHf eylopuptroouvcihdetsheinformatiiocnonown...
Owner's Manual
Page 12
...the and To alter various settings and the sewing functions, you touch , the window is closed without any settings being saved, Iblwfeaiynlslogicubtheseewxptiiottllisntiahtguiesot.onsmTecdrhaeeteiincnna,telhxlteyht ectbiemesntietrteectrhshteaosnresedttdtiittnchthgoesi2tsea.5nroespmieormnense.edistt,hstetoehtnethetoseetdiatlceh ... If you can othpeenwiandwoiwndoiswt,heIfnyoculocseodnfiarnmd your your finger. Single stitch selection The following screen shows the window that is closed without any set tings being changed. feature for the To use it, for ...
...the and To alter various settings and the sewing functions, you touch , the window is closed without any settings being saved, Iblwfeaiynlslogicubtheseewxptiiottllisntiahtguiesot.onsmTecdrhaeeteiincnna,telhxlteyht ectbiemesntietrteectrhshteaosnresedttdtiittnchthgoesi2tsea.5nroespmieormnense.edistt,hstetoehtnethetoseetdiatlceh ... If you can othpeenwiandwoiwndoiswt,heIfnyoculocseodnfiarnmd your your finger. Single stitch selection The following screen shows the window that is closed without any set tings being changed. feature for the To use it, for ...
Owner's Manual
Page 13
.... Yatouthceasntasrpt,ecoirfyatinthtehestsaertleacntidonentdh.atTtohuechmtahcehicnoerriesstpootniedionfgf icon. • If you touch the con. All options are selected in this window. + If you open the window, "Tie-off beginning" and 'Tie-off end" are cut the threads and raise the presser foot by... touching the icons. tIthyreoaudhcauvtetesrealnecdtepdretshseer"Tfoieo-ot flfifetenrda"reicoanc,tivthaeteidc.ons for selecting tie-offs. Touch to close the window and activate your seam will automatically tie-off. - determine the When you touch"Tie-off beginning", the beginning...
.... Yatouthceasntasrpt,ecoirfyatinthtehestsaertleacntidonentdh.atTtohuechmtahcehicnoerriesstpootniedionfgf icon. • If you touch the con. All options are selected in this window. + If you open the window, "Tie-off beginning" and 'Tie-off end" are cut the threads and raise the presser foot by... touching the icons. tIthyreoaudhcauvtetesrealnecdtepdretshseer"Tfoieo-ot flfifetenrda"reicoanc,tivthaeteidc.ons for selecting tie-offs. Touch to close the window and activate your seam will automatically tie-off. - determine the When you touch"Tie-off beginning", the beginning...
Owner's Manual
Page 14
... icon: WPafaabditrheticsctihhroeiwfsdefoqsuerunkaacmtlioplenlrne,ognygtgohtruhaa. "Patchwork" program (pat") 3, Twin needle function To adjust the length of the individual icons, see chapter 1. A window will not change . Press the beginning foot control and sew to open a previously saved program or create a new. All subsequent seams will be... selected stitch, the directly. A window opens allowing you to the desired length of the seam is automatically tied off , touch and then . The Press ...
... icon: WPafaabditrheticsctihhroeiwfsdefoqsuerunkaacmtlioplenlrne,ognygtgohtruhaa. "Patchwork" program (pat") 3, Twin needle function To adjust the length of the individual icons, see chapter 1. A window will not change . Press the beginning foot control and sew to open a previously saved program or create a new. All subsequent seams will be... selected stitch, the directly. A window opens allowing you to the desired length of the seam is automatically tied off , touch and then . The Press ...
Owner's Manual
Page 15
... To save the program and close the window. FATCHWPK\SE?,M1 PAT rrrr You can save the altered program under a 'Save as ", the menu is opened . . Saving on a creative momorj card: on the screen. 'Save...erase this designation with own choice. the program If you have created directories on the screen. a window for input of eight characters long. aOsthvapeameilecnaobitnnilmeg,oeffY,rtooThumehemctahcarayedrdchdaarorvirvdeec: aaTyrohddueisfrfwemeriaueshrnsetttobctwaeorodfpudelilninyf.feeinarescnehtrtdceradirv.deTdoaruticvthhees Touch to confirm your ...
... To save the program and close the window. FATCHWPK\SE?,M1 PAT rrrr You can save the altered program under a 'Save as ", the menu is opened . . Saving on a creative momorj card: on the screen. 'Save...erase this designation with own choice. the program If you have created directories on the screen. a window for input of eight characters long. aOsthvapeameilecnaobitnnilmeg,oeffY,rtooThumehemctahcarayedrdchdaarorvirvdeec: aaTyrohddueisfrfwemeriaueshrnsetttobctwaeorodfpudelilninyf.feeinarescnehtrtdceradirv.deTdoaruticvthhees Touch to confirm your ...
Owner's Manual
Page 16
... takes can delete the selected program. Touch the +1- To to continue without saving any icon for the individual functions and symbols. this function closes the window, 'Delete button: You can select all you have saved your settings. Twin needle Tnrdeehedecisudoclfreuaentdiycvotteoiuosnpwtriiaeltlclvlhuoeeswnests.wnyTeiothehuedaltseottiwbtscpirhneecawnikfeiaydegtdhtehleewain(wlSldieadaeuthltloCoomwhf aatytphioteceuartlwtlo6yi,nsbeew page 9). Tnstehiteicsdhlfeuhnafcrsotimobnetehmneucmshtaabcnehgiedndee,a. back Touch to return to...
... takes can delete the selected program. Touch the +1- To to continue without saving any icon for the individual functions and symbols. this function closes the window, 'Delete button: You can select all you have saved your settings. Twin needle Tnrdeehedecisudoclfreuaentdiycvotteoiuosnpwtriiaeltlclvlhuoeeswnests.wnyTeiothehuedaltseottiwbtscpirhneecawnikfeiaydegtdhtehleewain(wlSldieadaeuthltloCoomwhf aatytphioteceuartlwtlo6yi,nsbeew page 9). Tnstehiteicsdhlfeuhnafcrsotimobnetehmneucmshtaabcnehgiedndee,a. back Touch to return to...
Owner's Manual
Page 17
...direction. ) r-- Sewing in four directions without having to be used for free motion sewing by touching 'I Free motion You can set your Pfaff creative 2144 is ready to create a four sewing direc tions program. 1. When the desired length is lifted feed dog and attach the darning foot or... the direction arrows. I Four sewing directions You can program the length and width of a rectangle to turn the fabric. The following screen shows the window that opens when you can decide the first direction in , dlrctiOns t 4r Sf, r You have touched the and then the icon. i&H .1 ...
...direction. ) r-- Sewing in four directions without having to be used for free motion sewing by touching 'I Free motion You can set your Pfaff creative 2144 is ready to create a four sewing direc tions program. 1. When the desired length is lifted feed dog and attach the darning foot or... the direction arrows. I Four sewing directions You can program the length and width of a rectangle to turn the fabric. The following screen shows the window that opens when you can decide the first direction in , dlrctiOns t 4r Sf, r You have touched the and then the icon. i&H .1 ...
Owner's Manual
Page 20
...Last stitch 1 4 10 3 :: See page 4-13 Sequence/Combination In this menu, you can alter the density of your creative 2144. See page 4-20 • create embroidery combination by touching Touch 1 - This will under "decorative stitches" in stitches, existing memory combinations ...4-28 ) ) ) This allows you to close the window without stitches are especially suitable for that was last sewn before your designs. Note: The selection menu will disappear from a card can also personalize your Pfaff creative 2144 was turned off is automatically opened. See page 4-11 ...
...Last stitch 1 4 10 3 :: See page 4-13 Sequence/Combination In this menu, you can alter the density of your creative 2144. See page 4-20 • create embroidery combination by touching Touch 1 - This will under "decorative stitches" in stitches, existing memory combinations ...4-28 ) ) ) This allows you to close the window without stitches are especially suitable for that was last sewn before your designs. Note: The selection menu will disappear from a card can also personalize your Pfaff creative 2144 was turned off is automatically opened. See page 4-11 ...
Owner's Manual
Page 24
...Pres the threader F cer, .5th the henite Tt,reaier took P I to the previous opened one or more screens or close the Creative Assistant. Your Sewing and Embroidery Assistant can be used , whether the feed dog and the IDT system should be engaged, and which needle... tension suggestions. Touch to obtain information. Touch to select different fabrics. sewing blindhems and creating different pocket styles. and a pop-up information window in a pair of the screen. Instructions on the machine accessories to select another icon, for example. Touch to open , you touch '...
...Pres the threader F cer, .5th the henite Tt,reaier took P I to the previous opened one or more screens or close the Creative Assistant. Your Sewing and Embroidery Assistant can be used , whether the feed dog and the IDT system should be engaged, and which needle... tension suggestions. Touch to obtain information. Touch to select different fabrics. sewing blindhems and creating different pocket styles. and a pop-up information window in a pair of the screen. Instructions on the machine accessories to select another icon, for example. Touch to open , you touch '...
Owner's Manual
Page 26
...You can create and select your "Personal Menu" as "Language". Your settings are opened the context menu. Ii • Touch to confirm your Creative Assistant. to close a window without settings being ) saved. • Exception: When turning the opening screen on , the main menu will close the ) All "context" ... in the ii -: "Audio signal' menu. I ! The "context" Machine Settings menu You can select the language of your Pfaff crea tive 2144. If you to return to close your selection, the context menu will appear. 3. When the machine is shown as active and selected....
...You can create and select your "Personal Menu" as "Language". Your settings are opened the context menu. Ii • Touch to confirm your Creative Assistant. to close a window without settings being ) saved. • Exception: When turning the opening screen on , the main menu will close the ) All "context" ... in the ii -: "Audio signal' menu. I ! The "context" Machine Settings menu You can select the language of your Pfaff crea tive 2144. If you to return to close your selection, the context menu will appear. 3. When the machine is shown as active and selected....
Owner's Manual
Page 27
... the bobbin is wound when the machine is raised automatically to the selected position, when you touch the "Show dialogue" icon, the window for setting the presser foot height will be deleted) ToLch to confirm your selected audio signal icon again to confirm. Touch to delete... all information from the creative memory card. Will you really format? (all machine settings that you can enter a new name. The sewing machine is automatically set ...
... the bobbin is wound when the machine is raised automatically to the selected position, when you touch the "Show dialogue" icon, the window for setting the presser foot height will be deleted) ToLch to confirm your selected audio signal icon again to confirm. Touch to delete... all information from the creative memory card. Will you really format? (all machine settings that you can enter a new name. The sewing machine is automatically set ...
Owner's Manual
Page 29
...saved your settings. Confi. a message box appears. Touch if you menu choose to save o,erwrite settings in an your settings with in the Creative (A directory Data Manager. Save as Choose this function closes the menu. A 'Per message will appear to confirm your selection, Touch to ... Open Ocrpeeantesdth"ePemrsaocnhainl eM'senmue".mory in order to select a previously Use the arrow sonal Menu" in the "Personal Menu'. con, a window 'or selecting the direc- The menu's overview of he field with the changes. If you wish to icon to select each additional store in...
...saved your settings. Confi. a message box appears. Touch if you menu choose to save o,erwrite settings in an your settings with in the Creative (A directory Data Manager. Save as Choose this function closes the menu. A 'Per message will appear to confirm your selection, Touch to ... Open Ocrpeeantesdth"ePemrsaocnhainl eM'senmue".mory in order to select a previously Use the arrow sonal Menu" in the "Personal Menu'. con, a window 'or selecting the direc- The menu's overview of he field with the changes. If you wish to icon to select each additional store in...
Owner's Manual
Page 31
... Input. ) I DYcteroeneuadmtceivadonefo2pr1ro4ug4sreaaminndtahreedpePlmafyaofnfitsdtpereaartlmieorannsetoonfrttelhy.e. Note: If you have adjusted a program, also that you yourself A window is have entered. If you have entered are shown Select in the sewing machine, Playing a demo ...software status of your machine is saved, )v For programming a 'demo", touch the "Record demo" icon. a window appears, letting you yourself have closed a program, also that setting is saved Edit hoop This function size enables you ...
... Input. ) I DYcteroeneuadmtceivadonefo2pr1ro4ug4sreaaminndtahreedpePlmafyaofnfitsdtpereaartlmieorannsetoonfrttelhy.e. Note: If you have adjusted a program, also that you yourself A window is have entered. If you have entered are shown Select in the sewing machine, Playing a demo ...software status of your machine is saved, )v For programming a 'demo", touch the "Record demo" icon. a window appears, letting you yourself have closed a program, also that setting is saved Edit hoop This function size enables you ...
Owner's Manual
Page 34
... is reduced in menu "Join" taper from 0,2 mm to permanently save the you Tuphnreteilswsthidtehtheprorefevvtihoeerusszeliygkzseayeg.letschtteaerdwtsisdtaitthtc0hismwamiudttohamnisadtricbeaaelcclhyoemde. the window is then Touch , the window is available for speciality techniques. ETiysoaxaupalettrmeoirnespgdellieedsc:uatrTitdneigacffphseneereiwrqniiutnneeggf.wfeYhcoetusreroPrthfaaenffwgclierdesthawtiovhfeicthh2e1a4zr4iegzasaellgwownstsitch automatically. Touch icon. - cphsi.TnFgho.erTwmhiedittehsrtieotdcf htchowerilnzl eiagruszt,aogpmisvatotiittccyaholltuyarpbfeaerbcsroitmco...
... is reduced in menu "Join" taper from 0,2 mm to permanently save the you Tuphnreteilswsthidtehtheprorefevvtihoeerusszeliygkzseayeg.letschtteaerdwtsisdtaitthtc0hismwamiudttohamnisadtricbeaaelcclhyoemde. the window is then Touch , the window is available for speciality techniques. ETiysoaxaupalettrmeoirnespgdellieedsc:uatrTitdneigacffphseneereiwrqniiutnneeggf.wfeYhcoetusreroPrthfaaenffwgclierdesthawtiovhfeicthh2e1a4zr4iegzasaellgwownstsitch automatically. Touch icon. - cphsi.TnFgho.erTwmhiedittehsrtieotdcf htchowerilnzl eiagruszt,aogpmisvatotiittccyaholltuyarpbfeaerbcsroitmco...
Owner's Manual
Page 35
... for stitch No. 3 altered and No for the following and stitch 30 patterns. • 31.44,45, 131, 132.134,144.170. the window is then Touch , the window is ' icon to 0.35 stitches, the stitches mm stitch length and are the /- automatically 3 and 10 zigzag adjusted to reverse the needle turned...
... for stitch No. 3 altered and No for the following and stitch 30 patterns. • 31.44,45, 131, 132.134,144.170. the window is then Touch , the window is ' icon to 0.35 stitches, the stitches mm stitch length and are the /- automatically 3 and 10 zigzag adjusted to reverse the needle turned...
Owner's Manual
Page 39
... the To use it, touch icon for which you can easily sew on two and four hole ooTthuhLetteitlhoteirnnnneugsde.m.oofbAffetttrhiheeeo-fotptnstrtroiietsgcarahdauesmtsoa. The to close the window and save your set number of sttches (3). (For sewing nstructions see page 5-12) THPaiPnhlfesaeertofaheffseiaycrensordetuikeafcexftcheiepavraplneepantntfh2teia1nermt4dsioo4eefnnnapttuhroaaisibdrgs/moseamucsallrttaaeistnovehhuannetaicsllad.ahbibiefsolfseeuarsntfetotonorhrtveerieedcprfoveaininrreetswsinta.copcTefhphywaeeopahrureteeirnnris.g using the machine. The machine has individual...
... the To use it, touch icon for which you can easily sew on two and four hole ooTthuhLetteitlhoteirnnnneugsde.m.oofbAffetttrhiheeeo-fotptnstrtroiietsgcarahdauesmtsoa. The to close the window and save your set number of sttches (3). (For sewing nstructions see page 5-12) THPaiPnhlfesaeertofaheffseiaycrensordetuikeafcexftcheiepavraplneepantntfh2teia1nermt4dsioo4eefnnnapttuhroaaisibdrgs/moseamucsallrttaaeistnovehhuannetaicsllad.ahbibiefsolfseeuarsntfetotonorhrtveerieedcprfoveaininrreetswsinta.copcTefhphywaeeopahrureteeirnnris.g using the machine. The machine has individual...
Owner's Manual
Page 43
... stitches, a screen with the ' icon. • You can alter all settings of the screen. ethoevesrelaecptrioevnioisusclaynsceellelecdtedagcahina.racter or word if you have finished modifying the characters. A window is activated automatically. A name may be engaged. Save Use this function to give the sequence a name or rename t. Isteyqouuenmcoev. The tie-off program is opened...
... stitches, a screen with the ' icon. • You can alter all settings of the screen. ethoevesrelaecptrioevnioisusclaynsceellelecdtedagcahina.racter or word if you have finished modifying the characters. A window is activated automatically. A name may be engaged. Save Use this function to give the sequence a name or rename t. Isteyqouuenmcoev. The tie-off program is opened...
Owner's Manual
Page 46
...changes being saved, Make sure to M, the machine embroiders all areas in this command affects all three fields and the window is selected). Automatic hoop positioning WPfahfefncryeoaut;vpere2s1s 4t4hepfeorofot rcmontthreolctaolibstraarttioenmobnrociedemr,oryeour to select it. When calibrating, embroidery hoop size attached to... arrow must be made for the parameters. (jhe 80x80 hoop is closed . no additional changes can make changes. Touch the window is then Touch . being saved. On screen color changing Touch the • icon. of a color in where you confirm...
...changes being saved, Make sure to M, the machine embroiders all areas in this command affects all three fields and the window is selected). Automatic hoop positioning WPfahfefncryeoaut;vpere2s1s 4t4hepfeorofot rcmontthreolctaolibstraarttioenmobnrociedemr,oryeour to select it. When calibrating, embroidery hoop size attached to... arrow must be made for the parameters. (jhe 80x80 hoop is closed . no additional changes can make changes. Touch the window is then Touch . being saved. On screen color changing Touch the • icon. of a color in where you confirm...
Owner's Manual
Page 47
...will be cancelled. If you can rotate in left corner of the hoop. The 1 or functions, however, remain active. They - a window with your selected your settings saved. the embroidery If you confirm the message with the design again, you confirm the input with hoop moves ...the hoop. Touch the '0 + - They are switched off by touching the respective icon -g, o ++ If you confirm the message with , the window will be activated at the ' same time. Both touch the functions icon again or activate the cannot be closed and your finger or the stylus...
...will be cancelled. If you can rotate in left corner of the hoop. The 1 or functions, however, remain active. They - a window with your selected your settings saved. the embroidery If you confirm the message with the design again, you confirm the input with hoop moves ...the hoop. Touch the '0 + - They are switched off by touching the respective icon -g, o ++ If you confirm the message with , the window will be activated at the ' same time. Both touch the functions icon again or activate the cannot be closed and your finger or the stylus...