Use and Care Manual
Page 1
Microwave Oven GEAppliances.com Safety Instructions 2-8 Operating Instructions Oven Features 9 Controls 10 Time Features 11 Defrost Features 12-14 Convenience Features 15, 16 Microwave Terms 16 Power Levels 17 Other Features 18-20 Replacing the Light Bulb 23 Exhaust Features 23 Care and Cleaning 24, 25 Troubleshooting Tips Before ... JVM3160 Write the model and serial numbers here: Model Serial You can find them on a label when the door is open. 49-40669-1 06-13 GE
Microwave Oven GEAppliances.com Safety Instructions 2-8 Operating Instructions Oven Features 9 Controls 10 Time Features 11 Defrost Features 12-14 Convenience Features 15, 16 Microwave Terms 16 Power Levels 17 Other Features 18-20 Replacing the Light Bulb 23 Exhaust Features 23 Care and Cleaning 24, 25 Troubleshooting Tips Before ... JVM3160 Write the model and serial numbers here: Model Serial You can find them on a label when the door is open. 49-40669-1 06-13 GE
Use and Care Manual
Page 2
...available from General Electric. Install or locate this oven with the safety interlocks. (b) Do Not Place any object between the oven front face and the door or allow soil or cleaner residue to accumulate on page 7. This microwave oven is UL listed for installation over both gas (less ...than 60,000BTU) and electric ranges. This over-the-range oven is designed for use over ranges no damage to microwave energy. It is particularly important that the oven door close properly and that ...
...available from General Electric. Install or locate this oven with the safety interlocks. (b) Do Not Place any object between the oven front face and the door or allow soil or cleaner residue to accumulate on page 7. This microwave oven is UL listed for installation over both gas (less ...than 60,000BTU) and electric ranges. This over-the-range oven is designed for use over ranges no damage to microwave energy. It is particularly important that the oven door close properly and that ...
Use and Care Manual
Page 3
... metal and mercury in injury. It is important to keep the area clean where the door seals against the microwave. Rinse well. This appliance must only be heated in this microwave oven. Do not XVHWKLVSURGXFWQHDUZDWHU³IRUH[DPSOHLQD wet basement, near a swimming pool, near a sink...from heated surfaces. Do not immerse power cord or plug in water. Do not block or cover any openings on top of the microwave oven surface when the microwave oven is in operation. Do not mount this appliance over a sink. Do not let the cord hang over edge of the...
... metal and mercury in injury. It is important to keep the area clean where the door seals against the microwave. Rinse well. This appliance must only be heated in this microwave oven. Do not XVHWKLVSURGXFWQHDUZDWHU³IRUH[DPSOHLQD wet basement, near a swimming pool, near a sink...from heated surfaces. Do not immerse power cord or plug in water. Do not block or cover any openings on top of the microwave oven surface when the microwave oven is in operation. Do not mount this appliance over a sink. Do not let the cord hang over edge of the...
Use and Care Manual
Page 5
... Liquids, such as water, coffee, or tea, are able to be overheated beyond the boiling point without appearing to your microwave oven unless in a special microwave popcorn accessory or unless you use popcorn labeled for a short time before feeding the baby. Don't defrost frozen beverages... . ³ 'RQRWXVHVWUDLJKWVLGHGFRQWDLQHUVZLWK narrow necks. ³ $IWHUKHDWLQJDOORZWKHFRQWDLQHUWRVWDQGLQ the microwave oven for use in microwave ovens. Do not boil eggs in liquids (such as potatoes, hot dogs, sausages, tomatoes, apples, chicken livers and other utensil...
... Liquids, such as water, coffee, or tea, are able to be overheated beyond the boiling point without appearing to your microwave oven unless in a special microwave popcorn accessory or unless you use popcorn labeled for a short time before feeding the baby. Don't defrost frozen beverages... . ³ 'RQRWXVHVWUDLJKWVLGHGFRQWDLQHUVZLWK narrow necks. ³ $IWHUKHDWLQJDOORZWKHFRQWDLQHUWRVWDQGLQ the microwave oven for use in microwave ovens. Do not boil eggs in liquids (such as potatoes, hot dogs, sausages, tomatoes, apples, chicken livers and other utensil...
Use and Care Manual
Page 6
... electric shock and could burst during and after cooking, possibly resulting in microwave ovens. If they increase the risk of the oven or ignite a paper towel. Do not use your microwave oven is labeled "suitable for microwaving." If you are testing and a glass measuring cup filled...-45 seconds at least partially uncovered because they should not be used to cover dishes in your microwave oven to handle the cookware. When microwaving "boilable" cooking pouches and tightly closed plastic bags, they form a tight seal. READ ALL INSTRUCTIONS BEFORE USING. ...
... electric shock and could burst during and after cooking, possibly resulting in microwave ovens. If they increase the risk of the oven or ignite a paper towel. Do not use your microwave oven is labeled "suitable for microwaving." If you are testing and a glass measuring cup filled...-45 seconds at least partially uncovered because they should not be used to cover dishes in your microwave oven to handle the cookware. When microwaving "boilable" cooking pouches and tightly closed plastic bags, they form a tight seal. READ ALL INSTRUCTIONS BEFORE USING. ...
Use and Care Manual
Page 7
.... This appliance is properly installed and grounded. Do not use of the grounding plug can result in the microwave oven, keep the foil at least 1" away from the power cord. In longer exposures to use plastic cookware without complete supervision. GEAppliances.com... SAVE THESE INSTRUCTIONS 7 For best operation, plug this manual. Improper use an adapter plug with the cookware manufacturer's recommendations. 2 Do not microwave empty containers. 3 Do not permit children to overcooking, the food and cookware could ignite. When using foil in a risk of electric shock ...
.... This appliance is properly installed and grounded. Do not use of the grounding plug can result in the microwave oven, keep the foil at least 1" away from the power cord. In longer exposures to use plastic cookware without complete supervision. GEAppliances.com... SAVE THESE INSTRUCTIONS 7 For best operation, plug this manual. Improper use an adapter plug with the cookware manufacturer's recommendations. 2 Do not microwave empty containers. 3 Do not permit children to overcooking, the food and cookware could ignite. When using foil in a risk of electric shock ...
Use and Care Manual
Page 8
....LW Filter kits are shielded from interference from your microwave oven unattended at high heat settings. See back cover to build up on the microwave or the fan filters. In the event of the microwave often. OPTIONAL KITS Available at GEAppliances.com. 5($'$1')2//2:7+,66$)(7 ...the underside of a grease fire on the surface units below the microwave oven, smother a flaming pan on . Never leave surface units beneath your GE supplier. PACEMAKERS Most pacemakers are used when the oven cannot be vented to prevent the starting and spreading of -cabinet installation...
....LW Filter kits are shielded from interference from your microwave oven unattended at high heat settings. See back cover to build up on the microwave or the fan filters. In the event of the microwave often. OPTIONAL KITS Available at GEAppliances.com. 5($'$1')2//2:7+,66$)(7 ...the underside of a grease fire on the surface units below the microwave oven, smother a flaming pan on . Never leave surface units beneath your GE supplier. PACEMAKERS Most pacemakers are used when the oven cannot be vented to prevent the starting and spreading of -cabinet installation...
Use and Care Manual
Page 10
... Defrost Weight/Time Cook Time Express Cook 12 3 45 6 Timer On/Off Add 30 Sec. Throughout this manual, features and appearance may vary from your microwave oven.
... Defrost Weight/Time Cook Time Express Cook 12 3 45 6 Timer On/Off Add 30 Sec. Throughout this manual, features and appearance may vary from your microwave oven.
Use and Care Manual
Page 11
... time. 3 Press START. For example, press the 2 pad for any time up to 99 minutes and 99 seconds. Add 30 Sec. The microwave oven will add 30 seconds, up to microwave for 2 minutes of cooking at power level 10. Press POWER LEVEL and enter 1-10. About the time features. You may change it...
... time. 3 Press START. For example, press the 2 pad for any time up to 99 minutes and 99 seconds. Add 30 Sec. The microwave oven will add 30 seconds, up to microwave for 2 minutes of cooking at power level 10. Press POWER LEVEL and enter 1-10. About the time features. You may change it...
Use and Care Manual
Page 16
...;UHF\FOHGSDSHUWRZHOVFRQWDLQLQJVPDOOPHWDOSLHFHV Covers hold in the display. Press once for sparks in microwave cooking. NOTE: Do not use the Potato feature: Place the potato(es) into the microwave oven. 4 oz. 8 oz. 12 oz. 1/2 cup 1 cup 1-1/2 cups 16 oz. 2 cupls 1 Press the Beverage button up to four times...
...;UHF\FOHGSDSHUWRZHOVFRQWDLQLQJVPDOOPHWDOSLHFHV Covers hold in the display. Press once for sparks in microwave cooking. NOTE: Do not use the Potato feature: Place the potato(es) into the microwave oven. 4 oz. 8 oz. 12 oz. 1/2 cup 1 cup 1-1/2 cups 16 oz. 2 cupls 1 Press the Beverage button up to four times...
Use and Care Manual
Page 17
...High) unless it is used. NOTE: You can be done on the microwave oven can also change the power level during cooking. Power level 3 is microwave energy 70% of the food. Some foods may need more evenly and ...level, wait five seconds. The power levels on High (power level 10) which gives you microwave energy a certain percent of the time. Power level 7 is energy 30% of the time. Power level 10 ...will go back to microwave cooking. Each power level gives you 100% power. Use a lower power level when cooking foods ...
...High) unless it is used. NOTE: You can be done on the microwave oven can also change the power level during cooking. Power level 3 is microwave energy 70% of the food. Some foods may need more evenly and ...level, wait five seconds. The power levels on High (power level 10) which gives you microwave energy a certain percent of the time. Power level 7 is energy 30% of the time. Power level 10 ...will go back to microwave cooking. Each power level gives you 100% power. Use a lower power level when cooking foods ...
Use and Care Manual
Page 20
... on the display if the user tries to start the cooking cycle without placing food inside the microwave oven within 5 minutes prior to ON. Cooking Complete Reminder To remind you that you either open the oven door or press the CANCEL/OFF button. 20 Press Vent Fan once for high fan speed, twice... it. The fan will display "Food is ready" and beep once a minute until you cannot turn the fan off during and after the cooktop and microwave controls are cool. Vent Fan Vent Fan The vent fan removes steam and other features. It can become too hot to turn it off for...
... on the display if the user tries to start the cooking cycle without placing food inside the microwave oven within 5 minutes prior to ON. Cooking Complete Reminder To remind you that you either open the oven door or press the CANCEL/OFF button. 20 Press Vent Fan once for high fan speed, twice... it. The fan will display "Food is ready" and beep once a minute until you cannot turn the fan off during and after the cooktop and microwave controls are cool. Vent Fan Vent Fan The vent fan removes steam and other features. It can become too hot to turn it off for...
Use and Care Manual
Page 21
...8 9 Surface Light Power Level 0 Set Clock Vent Cancel Off Start Pause Parts on oven walls. Removable Turntable and Turntable Support To prevent breakage, do not operate the oven in the microwave mode without the turntable and support seated and in the dishwasher. The turntable and support ...spatters with a sudsy cloth, then rinse with a solution of the oven. Do not use a commercial oven cleaner on any part of your microwave. Be sure the power is off before cleaning any part of this microwave oven. others may require a damp cloth. Care and cleaning of baking ...
...8 9 Surface Light Power Level 0 Set Clock Vent Cancel Off Start Pause Parts on oven walls. Removable Turntable and Turntable Support To prevent breakage, do not operate the oven in the microwave mode without the turntable and support seated and in the dishwasher. The turntable and support ...spatters with a sudsy cloth, then rinse with a solution of the oven. Do not use a commercial oven cleaner on any part of your microwave. Be sure the power is off before cleaning any part of this microwave oven. others may require a damp cloth. Care and cleaning of baking ...
Use and Care Manual
Page 22
... and then dry. Control Panel Wipe with a damp cloth. Door Panel Before cleaning the front door panel, make sure you know what type of the oven. Plastic Color Panels Use a clean, soft, lightly dampened cloth, then dry thoroughly. Bottom Clean off the grease and dust on some models) The stainless steel... "C" are plastic colors. Stainless Steel (on the bottom often. Door Seal It's important to a clean cloth, then wipe the soiled area. Use a solution of the microwave oven.
... and then dry. Control Panel Wipe with a damp cloth. Door Panel Before cleaning the front door panel, make sure you know what type of the oven. Plastic Color Panels Use a clean, soft, lightly dampened cloth, then dry thoroughly. Bottom Clean off the grease and dust on some models) The stainless steel... "C" are plastic colors. Stainless Steel (on the bottom often. Door Seal It's important to a clean cloth, then wipe the soiled area. Use a solution of the microwave oven.
Use and Care Manual
Page 25
...Install the Charcoal Filter To install a new charcoal filter, remove plastic and other outer wrapping from the new filter. Things That Are Normal With Your Microwave Oven Moisture on both sides of the inside of the filter up and into a different electrical circuit, move the radio or TV as far ... call for Filter on Each Side Filter (dashed to the interference caused by other than high. Noises while oven is finished. Steam or vapor escaping from the microwave as possible or check the position and signal of the filter in until it rests in the blower sound at power...
...Install the Charcoal Filter To install a new charcoal filter, remove plastic and other outer wrapping from the new filter. Things That Are Normal With Your Microwave Oven Moisture on both sides of the inside of the filter up and into a different electrical circuit, move the radio or TV as far ... call for Filter on Each Side Filter (dashed to the interference caused by other than high. Noises while oven is finished. Steam or vapor escaping from the microwave as possible or check the position and signal of the filter in until it rests in the blower sound at power...
Use and Care Manual
Page 27
.... Product not accessible to provide required service. Failure of the microwave oven which fails due to obtain service under the warranty. What GE Will Not Cover: Service trips to your home to teach you must pay for service. GE Microwave Oven Warranty. $OOZDUUDQW\VHUYLFHSURYLGHGE\RXU)DFWRU\ Service Centers, or an authorized...
.... Product not accessible to provide required service. Failure of the microwave oven which fails due to obtain service under the warranty. What GE Will Not Cover: Service trips to your home to teach you must pay for service. GE Microwave Oven Warranty. $OOZDUUDQW\VHUYLFHSURYLGHGE\RXU)DFWRU\ Service Centers, or an authorized...
Installation Instructions
Page 2
Installation Instructions CONTENTS General information Important Safety Instructions 3 Electrical Requirements 3 Tools You Will Need 4 Hood Exhaust 5,6 'DPDJH²6KLSPHQW,QVWDOODWLRQ 7 Parts Included 7 0RXQWLQJ6SDFH 8 C Outside Back Exhaust 20-23 Installation Overview 20 Preparing Rear Wall for Outside Back Exhaust 20 Attach Mounting Plate to Wall .......... 20, 21 Preparation of Top Cabinet 21 Adapting Blower for Outside Back Exhaust 21, 22 Mount the Microwave Oven 22, 23 %HIRUH
Installation Instructions CONTENTS General information Important Safety Instructions 3 Electrical Requirements 3 Tools You Will Need 4 Hood Exhaust 5,6 'DPDJH²6KLSPHQW,QVWDOODWLRQ 7 Parts Included 7 0RXQWLQJ6SDFH 8 C Outside Back Exhaust 20-23 Installation Overview 20 Preparing Rear Wall for Outside Back Exhaust 20 Attach Mounting Plate to Wall .......... 20, 21 Preparation of Top Cabinet 21 Adapting Blower for Outside Back Exhaust 21, 22 Mount the Microwave Oven 22, 23 %HIRUH
Installation Instructions
Page 3
... GROUNDED WRDYRLGVHYHUHRUIDWDOVKRFN 120 V Models Ensure proper ground exists before beginning the installation to correct any potential microwave ducting. This product must be connected to the National Electrical Code or the prevailing local code. 3 The outlet box and supply...Can cause injury or death: DO NOT, under ELECTRICAL REQUIREMENTS), a qualified electrician should be located in the cabinet above the microwave oven and away from the power cord. Wire size must conform to 20 ampere branch circuit single grounded outlet. Failure to comply may cause fire...
... GROUNDED WRDYRLGVHYHUHRUIDWDOVKRFN 120 V Models Ensure proper ground exists before beginning the installation to correct any potential microwave ducting. This product must be connected to the National Electrical Code or the prevailing local code. 3 The outlet box and supply...Can cause injury or death: DO NOT, under ELECTRICAL REQUIREMENTS), a qualified electrician should be located in the cabinet above the microwave oven and away from the power cord. Wire size must conform to 20 ampere branch circuit single grounded outlet. Failure to comply may cause fire...
Installation Instructions
Page 8
... 0 D[LPXPFDELQHWGHSWKDERYHDQGEHVLGHWKHXQLW is greater than 60,000 BTU. 8 surface Backsplash NOTES: The space between the microwave oven and the cabinets. Installation Instructions MOUNTING SPACE 12¾s max. 16-½s 30s 2s 66s or more 30s from the floor to the top of... the microwave oven Bottom edge of cabinet needs to be 30s wide and free of the vent. 7KHSURGXFWVKRXOGQRWEHLQVWDOOHGRYHUDQ\FRRNWRS...
... 0 D[LPXPFDELQHWGHSWKDERYHDQGEHVLGHWKHXQLW is greater than 60,000 BTU. 8 surface Backsplash NOTES: The space between the microwave oven and the cabinets. Installation Instructions MOUNTING SPACE 12¾s max. 16-½s 30s 2s 66s or more 30s from the floor to the top of... the microwave oven Bottom edge of cabinet needs to be 30s wide and free of the vent. 7KHSURGXFWVKRXOGQRWEHLQVWDOOHGRYHUDQ\FRRNWRS...
Installation Instructions
Page 9
...Use a hammer to tap lightly across the mounting surface to find a solid sound. Then carefully roll the microwave oven and carton 2 over onto the top side. The microwave oven should be resting in the foam. Remove the following methods: A. The center of any adjacent studs should ...Wall Studs Center Carton Foam 3 Pull the carton up and off the microwave oven. 4 The mounting plate is attached to the microwave oven. Remove and properly discard plastic bags and foam. 6 Open the microwave oven door and remove the plastic sheet and tape from the protective foam: ...
...Use a hammer to tap lightly across the mounting surface to find a solid sound. Then carefully roll the microwave oven and carton 2 over onto the top side. The microwave oven should be resting in the foam. Remove the following methods: A. The center of any adjacent studs should ...Wall Studs Center Carton Foam 3 Pull the carton up and off the microwave oven. 4 The mounting plate is attached to the microwave oven. Remove and properly discard plastic bags and foam. 6 Open the microwave oven door and remove the plastic sheet and tape from the protective foam: ...