Get support for Pfaff creative 7550

Pfaff creative 7550 Support Question

Pfaff creative 7550 Support Question

Find answers below for this question about Pfaff creative 7550.
Need a Pfaff creative 7550 manual? We have 1 online manual for this item!
Question posted by dnewtonsagle on May 23rd, 2014

How To Fix Bobbin Casing For A Pfaff 7550.

The person who posted this question about this Pfaff product did not include a detailed explanation. Please use the "Request More Information" button to the right if more details would help you to answer this question.

Current Answers

Answer #1: Posted by Akashvikram on May 23rd, 2014 6:51 PM
Akashvikram

Member since:
May 7th, 2014

Points: 19,780
100
points
Checkout this website

1.ehow.com/how_8784827_fix-sewing-machine-bobbin-case.html

Related Pfaff creative 7550 Manual Pages

Owner's Manual - Page 2

... for another purpose than that intended or if it is 1 5 Watts. t- Dproodnuoct tussseuacnhyaisnspeectrtoiclid(geass)ororchtheimn icchalemicals for the sewing lamp is wet, e.g. Do not use only original PFAFF parts. with alcohol or paraffin. 8. r;;j I 1- 'I When leaving the machine, during work or when changing mechanical parts or accessories, always disconnect the...
Owner's Manual - Page 4

Parts of the creative 7550 (1) Bobbin thread monitor and sewing function light for "reverse sewing" (2> Key for "twin needle" (3) Key for "slow sewing" (4) Key for "needle up/down position" (5) Key... (26) Presser foot lifter (27) Needle holder with fixing screw (28) Detachable work support with accessory compartment (29) Sewing foot holder with sewing foot (30) Needle threader (31) Thread guide (32...
Owner's Manual - Page 6

... you . I 2. You have any help or advice you now take any material in desgin and technology, and this is 10 just as uncomplicated as your PFAFF sewing machine. II K So now you can do, and to learn all , this instruction book is the only way to ra K make full use of creating your...
Owner's Manual - Page 8

... bartack A Automatic darning Axial mirror image Balance N m s BBBBBaaaaasslllaitaacinnnncccgmeee,e,sfntsobiiutrudctehe(twsmotnaabhyrrtoso-ulisedpteictrmcoinhrergnecuco)triroenction Battery message Bias tape binder Blind stitch Bobbin case Bobbin Bobbin thread monitor winding Buttonholes Buttonholes with gimp thread Changing the battery Changing Changing the the letter width needle...
Owner's Manual - Page 9

... sequence) Letter selection using the "Creative Designer Linen buttonhole Linen embroidery Linen embroidery example - Gathering foot Gathering with elastic threads Gathering with straight stitch Hemstitching Hemstitch programs , Info Info as sewing recommendations Inserting letters Inserting stitches Inserting the bobbin Inserting the bobbin case Inserting the buttonhole guide Inserting...
Owner's Manual - Page 11

... feet for embroidery Sewing function keys Sewing functions Sewing on buttons Sewing on buttons with stems Sewing on patches Slow sewing Smocking with elastic thread Snap-in/out the sewing foot Sorting the...stitch Switching from upper to lower case script letters Switching on the main switch Symbols in the pattern sequence Symbol "mem' Taking out the bobbin case Threading Threading the needle Thread ...
Owner's Manual - Page 20

PFAFF creath'e 7550 iTT : I r P1I11ii1I5.161[hi[I9i0 do / i1 iiiAiz Contents Electrical connection Detachable work support Winding the bobbin Bobbin case Bobbin thread tension Threading the needle thread Needle threader Pulling up the bobbin thread Presser foot lifter Thread trimmer Changing the sewing foot Dual Feed Top feed Changing the needle Needle thread tension Dropping the feed dog...
Owner's Manual - Page 22

... can be rewound into the cord reel automatically, connection socket (44) of the foot control. Press the 'ok key and the sewing machine is Main switch When switching on the main switch (24) the sewing lamp lights up. Foot control cord Connecting the foot control Pull the foot control cord out of the...
Owner's Manual - Page 27

Taking out the bobbin case Lift the latch of the bobbin case and pull the bobbin case out. Release the empty bobbin. the latch and take out [ C I I E C ic Thread tension fTaaroneoccybotsrareienacmtolypstaiamdnjduumsbtuestdetoatnomheoaalpcephsetoahtrehaentrhc,reieeaa....
Owner's Manual - Page 28

...thread tension. Turn adjusting screw (C) just a little to the right to decrease the bobbin thread tension. The bobbin case must turn clockwise. 0 C C *: . Opening E of the hook. J I Lift latch F and push the bobbin case fully onto pin D of the sewing hook. I a0) .C 0 Inserting the bobbin case 1 I i Inserting the bobbin Insert the full bobbin in the opening (see arrow). .
Owner's Manual - Page 31

... has formed a loop. JE 11 : U) C A z; Pull the needle thread to bring up the bobbin thread Raise the sewing foot. J, 4 C ic Bobbin thread Close the hook cover (46) and pull the thread under the sewing foot to the front over the thread trimmer (49). 28 Thread trimmer Pull the threads from the back to the...
Owner's Manual - Page 41

... are too weak, you will loose the programmed P-Designs and the stored patterns in the machine, press the "o.k." If there are weak or no batteries in a pattern sequence. If ...Select the number of in your desired language using keys "O-7' From now on, any description on the sewing machine you will see the message ,,Change batteries" if the batte ries are no batteries have a choice of...
Owner's Manual - Page 44

...code press the "info" key. to sew. On will not appear. 0 L ThH11 1T L:4 I 0I cj, 4-'- 1- LI a, 2 -Q E a, - The sewing machine is again ready to sew. key the sewing start -up menu L WowsInifshhtttieehscnnehofsssawttr3iaeti0rcttcoh-shfuettisipentncgomhnuoeesnstnehudwtrhehtfeehoicorschesopewnarasrisnecettgicitduccimathsilpevalssecaehyawsiercneidrneegcieno.nmIsgt.rbcoiounpends...
Owner's Manual - Page 67

...slide of the H' Designer. on the screen. (I PFAFF creatiSO i3iTi 5J! __ 'I ) C.) 1-' a) 2 Ea) 65 To do this, connect the CD to be sewn. First press the "" key. By pressing the "mem +" key sewing machine (see section ,,Creative Designer"). bet style. 1 II Ff4 iE1[11 ...be confirmed H' Press the "A-z" key and select the desired alpha and ready to your Creative Designer.
Owner's Manual - Page 88

... into the sewing machine's computer by the adjustable slide stitch by stitch. 30 program memories are available from your disposal, from P0-29. E H 88 I II 1/ i•1 I U F PFAF F The Creative Designer comes as standard equipment with the creative 7550 and enables you to design your own patterns up to -sew pattern templates are at your PFAFF dealer. Ready...
Owner's Manual - Page 89

Ea) [ _cQa)) PFAFF 89 C 0 U) U) .C Cl) 2; I j I j I- 11 I Parts of the Creative Designer 1 Connection lead with plug 2 Cover I 3 Lead retainer 4 Adjustable slide i 5 Sliding scanner with cross-wire magnifier 6 Cross-wire magnifier i I 7 Clip slide,... input" key (mem +) 1 2 Clip slide, left The illustration below shows you how the Crea tive Designer is stored in the carrying case.
Owner's Manual - Page 95

... 00 and check that the red horizontal line of the Designer by pushing the clip slides to the front. When connecting the CD to your sewing machine it into place as described on pages 93/94. Open the insertion slot of the magnifier aligns with lire 00. (Adjust, if necessary.) C aco 0 oa...
Owner's Manual - Page 135

...on the display next to the buttonhole.The buttonhole will then be sewn automatically, however, the sewing machine will reduce the sewing speed before the buttonhole is finished. _r I :1 I irriri I .'- Defining the second ... seam has reached the length of 4.5 mm can interrupt the slow sewing at the end. The creative will be adjusted with "man" has to be displayed containing the length...
Owner's Manual - Page 162

...machine without fabric in . Do not wind thread free-hand, but run it . Remove loose thread and apply one drop of fabric. Enter the desired program again. If you insert the bobbin case... left. 6. See needle chart (pages 157/158). Only guide the fabric lightly. Machine does not feed or feeds irregularly Sewing lint has collected between the feed dog teeth rows. Push slide B (see page ...
Owner's Manual - Page 166

...Each pattern of the machine is pre-programmed ... or heavy woollens, however, you use thin or thick materials, they the bobbin case slightly to be embroidered.This will look more evenly and been stabilized. The gel...you should Thread tension adjust your pattern with dense embroidery stitches. We, there Sewing feet fore, recommend: I . Avalon is used to dry after the embroidery...

Similar Questions

What Is The Part Number Of The Bobbin Case For A Hobbymatic 919-1
Part number hobbymatic 929-1 bobbin case
(Posted by grahamnmarkthompson 2 years ago)
Threading Piaf 7550 Sewing Machine
I received this machine without a manual. No luck downloading it and YouTube videos weren't clear. I...
(Posted by Nwegmann 8 years ago)
How To Fix A Bobbin Casing On Pfaff 7550
I hit a pin and now my needle hits the metal of the bobbin casing. I have chanved the needle but whe...
(Posted by dnewtonsagle 9 years ago)
Bobbin Case For Pfaff Creative 1473 Cd. Good Price? Where?
Need source to buy bobbin case/good price.
(Posted by Debbyep 10 years ago)
The Presser Foot On My Pfaff Creative 7550 Sewing Machine No Longer Drops Down.
When presser foot lever is disengaged presser foot does not drop
(Posted by lkjorstad 11 years ago)
Ask a New Question
Use the box below to post a new question about this Pfaff product .
Points & Prizes
  • You can earn points for nearly everything you do on HelpOwl.com
  • You can trade in those points for gift cards at leading retailers such as Amazon.com and Walmart
  • It's that simple!
See How it Works
Create a Free Account

Pfaff Manuals

Find free Pfaff creative 7550 manuals and user guides available at ManualOwl.com. Try out our unique manual viewer allowing you to interact with manuals from directly within your browser!

Pfaff Reviews

View thousands of Pfaff user reviews and customer ratings available at ReviewOwl.com.

Contact Information

Complete Pfaff customer service contact information including steps to reach representatives, hours of operation, customer support links and more from ContactHelp.com.

Scoreboard Ratings

See detailed Pfaff customer service rankings, employee comments and much more from our sister site.