Get support for Pfaff creative 7550

Pfaff creative 7550 Support Question

Pfaff creative 7550 Support Question

Find answers below for this question about Pfaff creative 7550.
Need a Pfaff creative 7550 manual? We have 1 online manual for this item!
Question posted by lmcrossley on June 2nd, 2014

Pfaff Creative Passcode

I have inherited a Pfaff Creative 7550. I don't know the passcode. How do I reset it please?

Current Answers

Answer #1: Posted by online24h on June 2nd, 2014 8:30 PM
This answer was accepted by the poster of the original question.
online24h

Member since:
March 28th, 2014

Points: 531,660
1,100
points


Hope this will be helpful "PLEASE ACCEPT"

Related Pfaff creative 7550 Manual Pages

Owner's Manual - Page 2

... or liquids. Ambient temperature 1 0°C to 40° C Humidity 20% to use the sewing machine if: - The tension of the drive belt must be adjusted by its function is solely the ... the machine from the mains by hitting or dropping. The maximum permissible wattage for the sewing lamp is wrongly operated, we will not accept any damage caused. Do not use only original PFAFF parts...
Owner's Manual - Page 3

creative 7550 ...S R3i rE I 35 - 1 2345 ,- * 6 71 W4N P A F c ,ative 7550 U- 9 :25 17 15 36 37 -' 3829 i; I PFAFF 51 fl - L' F-
Owner's Manual - Page 6

... 6. - You have any material in desgin and technology, and this is 10 just as uncomplicated as your PFAFF sewing machine. advantages. It features the very latest in its stride and will be at your fashion ideas. I 3. 4. Ej Sewing by touch-key 7. Ii p. ii El -I 2 a 9 Nol K Note maci Secti I 1. 1 II I I El 1I K After all, this...
Owner's Manual - Page 22

I I 19 Press the 'ok key and the sewing machine is Main switch When switching on the main switch (24) the sewing lamp lights up. Connect the plug of the foot control with the It can be rewound into the cord reel automatically, connection socket (44) of ...
Owner's Manual - Page 40

I Contents Start-up functions Pages 38-43 C Sewing function keys Pages 44-45 Pattern selection Pages 46-48 Stitch length and width Pages 49-50 ii; ck 7 \• I 0 I I ri e', 0 U) 0 \ '- •\ J :- Info Page 51 0 Maxi Stitches Pages 52-54 Balance Pages 55-57 G) • 2: E : 37 I F PFAFF creative 7550 ii' ! I I .1 r. . -' - - - Ii II ii p I...
Owner's Manual - Page 41

... be disposed of several languages. U, '4- z EiLiLii Language selection Hold key "1" pressed and switch on the sewing machine you have been inserted. key or activate the foot control.The machine is now ready to sew. When switching on the sewing machine. On the display you will loose the programmed P-Designs and the stored patterns in the selected...
Owner's Manual - Page 44

...,thperesstsartth-uep"emsce"nukeayn. key. The sewing machine is again ready to sew. to sew. On will not appear. 0 L ThH11 1T L:4 I menu\ r o,k. 1 11 ) 0-9 clear Explanation of the start-up menu L WowsInifshhtttieehscnnehofsssawttr3iaeti0rcttcoh-shfuettisipentncgomhnuoeesnstnehudwtrhehtfeehoicorschesopewnarasrisnecettgicitduccimathsilpevalssecaehyawsiercneidrneegcieno...
Owner's Manual - Page 47

... the bobbin thread. The red diode lights up , the machine sews backwards. To tie-off . 1 Slow sewing (3) By pressing this key if you can use this key to avoid the needle stitching on less the than 2 bobbin. PFAFF creative 75! 1 Mnda In G Description of the sewing function keys Reverse key (25) By pressing the reverse key...
Owner's Manual - Page 67

.... (I PFAFF creatiSO i3iTi 5J! First press the "" key. To do this, connect the CD to be confirmed H' Press the "A-z" key and select the desired alpha and ready to your Creative Designer. I Il I I I I Letter selection using the Creative special marks with the adjustable slide of the H' Designer. By pressing the "mem +" key sewing machine (see section ,,Creative...
Owner's Manual - Page 74

...posi Pressing the key below it you select the key below the "sewing machine" IC L [ [ icon and your sewing machine is ready to the end of the sequence. Now press the key... of the cursor; key or abort by pressing the "o.k." m -: Deleting the entire sequence: If you will move to sew. [ [ [ 72 i key, you press this screen. 1 f L p4 _. the figure below it describes the...
Owner's Manual - Page 88

... inserted into the sewing machine's computer by the adjustable slide stitch by stitch. 30 program memories are available from P0-29. I II 1/ i•1 I U F PFAF F The Creative Designer comes as standard equipment with the creative 7550 and enables you to design your own patterns up to -sew pattern templates are at your disposal, from your PFAFF dealer. E H 88...
Owner's Manual - Page 95

... into place as described on pages 93/94. I ) t;.c LI 2 Ea) -Cl) C) 0O 95 CC3 i-if Check: Push the magnifier back to your sewing machine. Remember! Open the insertion slot of the magnifier aligns with lire 00. (Adjust, if necessary.) C aco 0 oa()I - Insert the programming sheet in the CD and ...
Owner's Manual - Page 96

Press the numbered key below the desired free "P-Memory" I II 96 r Using cursor key"*" you can scroll to your sewing machine press key"p)" E a) a)' 00.. 1 On the screen the first 10 of 30 P-Memories are displayed. [ r 1 ' C- Selecting a P-Memory To transfer the design to the next page.
Owner's Manual - Page 135

... a wide buttonhole width, for any further buttonholes. When you press the "o.k." C The machine will sew at the end. _r I :1 I irriri I .'- key afterwards, a new screen will sew the second bartack and tie-off at normal speed and finish the buttonhole. The creative will be displayed containing the length and width of the first seam, press...
Owner's Manual - Page 137

... as the second buttonhole seam has reached the length of the first seam, the sewing machine will automatically sew the second bartack and tie-off, Note: This only applies when the buttonhole guide is finished, the sewing machine will reduce the sewing speed. r defined by pressing the key below"man' 4 C., I w The total length of buttonhole foot...
Owner's Manual - Page 159

.... Only use leak-proof batteries! Note: After changing the batteries the contents of the memories during the battery change. Changing the battery: Switch on the sewing machine to avoid dele tion of the memories should be checked, Spare batteries: 2 Mignon cells 1.5V; A battery compartment is installed in the base. Insert the new...
Owner's Manual - Page 160

...8226; Pull the stitch plate upwards in the back and remove it snap in other places. • Clean and oil the sewing machine every 10 to the hook as shown above. a) 142 0) a) 1 cC (-I 0)a) 0). Before you hear it . ...the feed dog and hook area with both hands until you start sewing, check that the needle i plate is otherwise maintenance-free and must not be oiled in place.
Owner's Manual - Page 161

wainnggemathcheinbeulobnwteherehcaonmd • Hold the sewing machine tightly. • Push the bulb go. into the holder and turn it remove it is 15 WattSl o(n 162 and the foot control &#... it will a turn) to Insert10 • Insert the bulb in the diagonal holder and turn it so that both stopS of the sewing machin Removal Twmoheemnedal kpaelsaicitlilenuagssttireharetetdose.
Owner's Manual - Page 178

...material. L Using the "needle down" function makes this part of the • To make with your sewing machine. I- 180 along their contours,but do is dissolve the No. 00 (stitch length at about 2 mm...8226; Then place two plies of AVALON stabilizer under the area to make the embroidery more stable, sew work easier! around all you have to do not cut out the fabric from the dery is easy...
Owner's Manual - Page 179

... very precise. The • In traditional quilts these three layers of polyester padding with program II No. 00. There is a traditional sewing technique. but just smoothed out - The And this is often also bordered with the back layer. • Tack your quilt with small... of the quilt onto the layer of mate Dual Feed is quicker and more practical with the sewing machine, e.g.

Similar Questions

I Need A Cord For Pfaff Creative 7550
I have a pfaff creative 7550 without a cord. Can I order one
(Posted by bjchoury 1 year ago)
The Sewing Machine Will Say Calibrate Embroidery Unit. I Click The Check Mark T
when I click on calibrate the sewing machine goes into thinking mode & it just does it for a long ti...
(Posted by Anonymous-156748 8 years ago)
Pfaff 259 Sewing Machine Won't Run With Foot Petal
I have a pfaff 259. When I push on the foot petal the motor runs but the machine itself doesn't run....
(Posted by Aemazing 8 years ago)
Threading Piaf 7550 Sewing Machine
I received this machine without a manual. No luck downloading it and YouTube videos weren't clear. I...
(Posted by Nwegmann 8 years ago)
The Presser Foot On My Pfaff Creative 7550 Sewing Machine No Longer Drops Down.
When presser foot lever is disengaged presser foot does not drop
(Posted by lkjorstad 11 years ago)
Ask a New Question
Use the box below to post a new question about this Pfaff product .
Points & Prizes
  • You can earn points for nearly everything you do on HelpOwl.com
  • You can trade in those points for gift cards at leading retailers such as Amazon.com and Walmart
  • It's that simple!
See How it Works
Create a Free Account

Pfaff Manuals

Find free Pfaff creative 7550 manuals and user guides available at ManualOwl.com. Try out our unique manual viewer allowing you to interact with manuals from directly within your browser!

Pfaff Reviews

View thousands of Pfaff user reviews and customer ratings available at ReviewOwl.com.

Contact Information

Complete Pfaff customer service contact information including steps to reach representatives, hours of operation, customer support links and more from ContactHelp.com.

Scoreboard Ratings

See detailed Pfaff customer service rankings, employee comments and much more from our sister site.